PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013621081.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 198aa    MW: 22880.8 Da    PI: 9.1712
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013621081.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.11.3e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W +eEd +l  +v  +G g+W+ I+r+ g++R +k+c++rw +yl
   XP_013621081.1 14 RGLWKPEEDMILRSYVDTHGEGNWADISRRSGLKRGGKSCRLRWKNYL 61
                     788*****************************99************97 PP

2Myb_DNA-binding51.72e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +T++E++l+++ +k+lG++ W++Ia +++ gRt++++k++w+++l
   XP_013621081.1  67 RGGMTPQEQDLIIRMHKLLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 112
                      6789******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.005961IPR017930Myb domain
SuperFamilySSF466894.4E-2912108IPR009057Homeodomain-like
SMARTSM007172.4E-131363IPR001005SANT/Myb domain
PfamPF002495.5E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-221568IPR009057Homeodomain-like
CDDcd001672.30E-91761No hitNo description
PROSITE profilePS5129425.02762116IPR017930Myb domain
SMARTSM007171.1E-1566114IPR001005SANT/Myb domain
PfamPF002498.1E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-2469115IPR009057Homeodomain-like
CDDcd001675.85E-1170112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MEKREEERKT HVKRGLWKPE EDMILRSYVD THGEGNWADI SRRSGLKRGG KSCRLRWKNY  60
LRPNIKRGGM TPQEQDLIIR MHKLLGNRWS LIAGRLPGRT DNEVKNYWNT HLNKKSSSRK  120
QNATESVEAT PWVDKPVMST EGRGSHGGGE GEEDTTTTWM EETNFFARIE SPQPLTAHYP  180
DTLCFDPSFA FTDCFPLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-231211525127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013621081.11e-148PREDICTED: transcription factor MYB82
SwissprotQ9LTF71e-111MYB82_ARATH; Transcription factor MYB82
TrEMBLA0A0D3AMP91e-148A0A0D3AMP9_BRAOL; Uncharacterized protein
STRINGBra022602.1-P1e-132(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52600.13e-98myb domain protein 82